Breast carcinoma amplified sequence 2

UniProt : B2R7W3, O75934, UniProt ID: B2R7W3_HUMAN, SPF27_HUMAN,

Breast carcinoma amplified sequence 2

Homo sapiens

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA
FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVR
IENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLRE
MESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Breast carcinoma amplified sequence 2 contains a PF05700 domain.

Breast carcinoma amplified sequence 2 is proteolytically cut by caspase () cleavage. VVVD-ALPY.