Isoform II of Tumor necrosis factor receptor superfamily member 5

UniProt : P25942, UniProt ID: P25942-2,

Isoform II of Tumor necrosis factor receptor superfamily member 5

Homo sapiens

MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHH
LRDPVCHPLGAGLYQKGGQEANQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform II of Tumor necrosis factor receptor superfamily member 5 contains a PF00020 domain.

Isoform II of Tumor necrosis factor receptor superfamily member 5 is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..