Isoform II of Tumor necrosis factor receptor superfamily member 5
Isoform II of Tumor necrosis factor receptor superfamily member 5 Homo sapiens MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHH LRDPVCHPLGAGLYQKGGQEANQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform II of Tumor necrosis factor receptor superfamily member 5 contains a PF00020 domain.
Isoform II of Tumor necrosis factor receptor superfamily member 5 is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..