cDNA FLJ76379, highly similar to Homo sapiens transforming growth factor, alpha (TGFA), mRNA (Transforming growth factor, alpha, isoform CRA_c)

UniProt : A8K286, P01135, UniProt ID: A8K286_HUMAN, TGFA_HUMAN,

cDNA FLJ76379, highly similar to Homo sapiens transforming growth factor, alpha (TGFA), mRNA (Transforming growth factor, alpha, isoform CRA_c)

Homo sapiens

MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76379, highly similar to Homo sapiens transforming growth factor, alpha (TGFA), mRNA (Transforming growth factor, alpha, isoform CRA_c) contains a PF00008 domain.

cDNA FLJ76379, highly similar to Homo sapiens transforming growth factor, alpha (TGFA), mRNA (Transforming growth factor, alpha, isoform CRA_c) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. DLLA-VVAA.

cDNA FLJ76379, highly similar to Homo sapiens transforming growth factor, alpha (TGFA), mRNA (Transforming growth factor, alpha, isoform CRA_c) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. VAAA-VVSH.

cDNA FLJ76379, highly similar to Homo sapiens transforming growth factor, alpha (TGFA), mRNA (Transforming growth factor, alpha, isoform CRA_c) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. VAAA-VVSH.