Cartilage oligomeric matrix protein

UniProt : P49747, UniProt ID: COMP_HUMAN,

Cartilage oligomeric matrix protein

Homo sapiens

MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cartilage oligomeric matrix protein contains a PF00008 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF02412 domain.

Cartilage oligomeric matrix protein contains a PF05735 domain.

Cartilage oligomeric matrix protein contains a PF07645 domain.

Cartilage oligomeric matrix protein is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. TLTD-FRAF.

Cartilage oligomeric matrix protein is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. PNWV-VLNQ.