Putative uncharacterized protein

UniProt : P48030, Q545E4, UniProt ID: Q545E4_MOUSE, TGFA_MOUSE,

Putative uncharacterized protein

Mus musculus

MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR
FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00008 domain.

Putative uncharacterized protein is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..