Oxytocin-neurophysin 1

UniProt : P13389, UniProt ID: NEU1_SHEEP,

Oxytocin-neurophysin 1

Ovis aries

MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCG
DELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEA
AFSQH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Oxytocin-neurophysin 1 contains a PF00220 domain.

Oxytocin-neurophysin 1 contains a PF00184 domain.

Oxytocin-neurophysin 1 is proteolytically cut by (M9G.025) cleavage. GGKR-AAPD.