Hemoglobin subunit alpha

UniProt : P01966, UniProt ID: HBA_BOVIN,

Hemoglobin subunit alpha

Bos taurus

MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
AKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTP
AVHASLDKFLANVSTVLTSKYR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hemoglobin subunit alpha contains a PF00042 domain.

Hemoglobin subunit alpha is proteolytically cut by plasmepsin 2 (A01.023) cleavage. ERMF-LSFP.

Hemoglobin subunit alpha is proteolytically cut by plasmepsin 1 (A01.022) cleavage. ERMF-LSFP.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. --MV-LSAA.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. AAEY-GAEA.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. LLVT-LASH.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. LERM-FLSF.

Hemoglobin subunit alpha is proteolytically cut by plasmepsin 2 (A01.023) cleavage. ERMF-LSFP.

Hemoglobin subunit alpha is proteolytically cut by plasmepsin 1 (A01.022) cleavage. ERMF-LSFP.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. --MV-LSAA.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. AAEY-GAEA.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. LLVT-LASH.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. LERM-FLSF.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. ANVS-TVLT.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. LERM-FLSF.

Hemoglobin subunit alpha is proteolytically cut by cathepsin D (A01.009) cleavage. STVL-TSKY.