Insulin-like growth factor-binding protein 5

UniProt : P24593, UniProt ID: IBP5_HUMAN,

Insulin-like growth factor-binding protein 5

Homo sapiens

MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-like growth factor-binding protein 5 contains a PF00219 domain.

Insulin-like growth factor-binding protein 5 contains a PF00086 domain.

Insulin-like growth factor-binding protein 5 is proteolytically cut by mannan-binding lectin-associated serine peptidase 3 (S01.132) cleavage. AHPR-IISA.

Insulin-like growth factor-binding protein 5 is proteolytically cut by mannan-binding lectin-associated serine peptidase 3 (S01.132) cleavage. YSPK-IFRP.

Insulin-like growth factor-binding protein 5 is proteolytically cut by mannan-binding lectin-associated serine peptidase 3 (S01.132) cleavage. FRPK-HTRI.

Insulin-like growth factor-binding protein 5 is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

Insulin-like growth factor-binding protein 5 is proteolytically cut by mannan-binding lectin-associated serine peptidase 3 (S01.132) cleavage. AHPR-IISA.

Insulin-like growth factor-binding protein 5 is proteolytically cut by mannan-binding lectin-associated serine peptidase 3 (S01.132) cleavage. YSPK-IFRP.

Insulin-like growth factor-binding protein 5 is proteolytically cut by mannan-binding lectin-associated serine peptidase 3 (S01.132) cleavage. FRPK-HTRI.

Insulin-like growth factor-binding protein 5 is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

Insulin-like growth factor-binding protein 5 is proteolytically cut by pappalysin-2 (M43.005) cleavage. LTQS-KFVG.

Insulin-like growth factor-binding protein 5 is proteolytically cut by thrombin (S01.217) cleavage. AHPR-IISA.

Insulin-like growth factor-binding protein 5 is proteolytically cut by thrombin (S01.217) cleavage. FRPK-HTRI.

Insulin-like growth factor-binding protein 5 is proteolytically cut by thrombin (S01.217) cleavage. MVPR-AVYL.

Insulin-like growth factor-binding protein 5 is proteolytically cut by pappalysin-1 (M43.004) cleavage. LTQS-KFVG.

Insulin-like growth factor-binding protein 5 is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

Insulin-like growth factor-binding protein 5 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

Insulin-like growth factor-binding protein 5 is proteolytically cut by pappalysin-1 (M43.004) cleavage..