Major fimbrial subunit protein type-1

UniProt : P13793, UniProt ID: FIMA1_PORGI,

Major fimbrial subunit protein type-1

Porphyromonas gingivalis

MVLKTSNSNRAFGVGDDESKVAKLTVMVYNGEQQEAIKSAENATKVEDIKCSAGQRTLVV
MANTGAMELVGKTLAEVKALTTELTAENQEAAGLIMTAEPKTIVLKAGKNYIGYSGTGEG
NHIENDPLKIKRVHARMAFTEIKVQMSAAYDNIYTFVPEKIYGLIAKKQSNLFGATLVNA
DANYLTGSLTTFNGAYTPANYANVPWLSRNYVAPAADAPQGFYVLENDYSANGGTIHPTI
LCVYGKLQKNGADLAGADLAAAQAANWVDAEGKTYYPVLVNFNSNNYTYDSNYTPKNKIE
RNHKYDIKLTITGPGTNNPENPITESAHLNVQCTVAEWVLVGQNATW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Major fimbrial subunit protein type-1 contains a PF06321 domain.

Major fimbrial subunit protein type-1 is proteolytically cut by gingipain R (C25.001) cleavage. NSNR-AFGV.