cDNA, FLJ93186, Homo sapiens seryl-tRNA synthetase (SARS), mRNA (Seryl-tRNA synthetase, isoform CRA_e)

UniProt : B2R6Y9, P49591, UniProt ID: B2R6Y9_HUMAN, SYSC_HUMAN,

cDNA, FLJ93186, Homo sapiens seryl-tRNA synthetase (SARS), mRNA (Seryl-tRNA synthetase, isoform CRA_e)

Homo sapiens

MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAE
RIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEP
SKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93186, Homo sapiens seryl-tRNA synthetase (SARS), mRNA (Seryl-tRNA synthetase, isoform CRA_e) contains a PF00587 domain.

cDNA, FLJ93186, Homo sapiens seryl-tRNA synthetase (SARS), mRNA (Seryl-tRNA synthetase, isoform CRA_e) contains a PF02403 domain.

cDNA, FLJ93186, Homo sapiens seryl-tRNA synthetase (SARS), mRNA (Seryl-tRNA synthetase, isoform CRA_e) is proteolytically cut by caspase-3 (C14.003) cleavage. EVTD-A---.