Growth/differentiation factor 11

UniProt : Q9Z1W4, UniProt ID: GDF11_MOUSE,

Growth/differentiation factor 11

Mus musculus

MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAGVGGERSSRPAPSAPPEPDGC
PVCVWRQHSRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQGD
ALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWV
YLRPVPRPATVYLQILRLKPLTGEGTAGGGGGGRRHIRIRSLKIELHSRSGHWQSIDFKQ
VLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENTKRSRRNLGL
DCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQA
NPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Growth/differentiation factor 11 contains a PF00019 domain.

Growth/differentiation factor 11 contains a PF00688 domain.

Growth/differentiation factor 11 is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. RSRR-NLGL.