Nucleolin

UniProt : P09405, UniProt ID: NUCL_MOUSE,

Nucleolin

Mus musculus

MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTP
AKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVP
TPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPA
KAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVA
EEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKV
EGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAE
DLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAME
IRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTS
TWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEA
LNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTD
RETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGF
GGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Nucleolin contains a PF00076 domain.

Nucleolin contains a PF00076 domain.

Nucleolin contains a PF00076 domain.

Nucleolin contains a PF00076 domain.

Nucleolin is proteolytically cut by granzyme B, human-type (S01.010) cleavage. SEAD-AEKN.

Nucleolin is proteolytically cut by granzyme B, human-type (S01.010) cleavage. ITED-ELKE.