Protein MRVI1

UniProt : Q9N1F0, UniProt ID: MRVI1_BOVIN,

Protein MRVI1

Bos taurus

MVKAPQSEERLAGGGKGNNSVLACGAQASWSIFGADAAEVPGTRSHSRQEAAMPHIPEDE
EPPGEPQAAQSPAGQDPATTGISCSPPTIILTGDASSPEGETDKNPVNRAHSPHRRLSHR
HLKVSTASLTSVDPAGHVIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRK
SRSSPGESSPAVSPNLSPGASPASSQSNSLTVPTPPGLDVCSGPPSPLPGAPPQKGDEAE
VPSPHLGESNVLKGLADRKQNDQRTLSQGRLTARSPTVEKSKEITIEQKENFDPLQRPEA
IPKGPASGPGSGGKMALNSPQPGPVESELGKPLAKTAKEGNPLPRGPTQGSGGVAPQASQ
GKSTVGEPAGSKVGSKAELWPPTSRPPLLRGVSWDSGPEEPGPRLQKVLAKLPLAEEEKR
FTGKAGSKLAKAPGLKDFQIQVQPVRMQKLTKLREEHILLRNQNLVGLKLPELSEAAEQE
KGHPSELSSAIEEEESKGGLDVMPNISDVLLRKLRVHKSLPGSAPPLTEKEVENVFVQLS
LAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASLWHHCEHRETYQKLLE
DIAVLHRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKLA
NQNSSRSCGPSEDGVPRTARSMSLSLGKNMPRRRVSVAVVPKFNILNLPGQSPSSSPIPS
LPALSESSNGKGNPPVSSALPALLENGKTNGDPDCEASASVPTPSCLEGISQEAKARMEE
EAYNKGYQEGLKKTKELQGLREEEEEQKSESPEEPEEVAETEEEEKEQRSSKLEELVHFL
QVMYPKLCQHWQVIWMMAAAMLVLTVVLGLYGSHNSCVEQADGSLGKSTCSAAQRDSWWS
SGLQHEQPTEQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein MRVI1 contains a PF05781 domain.

Protein MRVI1 is proteolytically cut by () cleavage..