Putative uncharacterized protein

UniProt : Q07079, Q3UQV0, UniProt ID: IBP5_MOUSE, Q3UQV0_MOUSE,

Putative uncharacterized protein

Mus musculus

MVISVVLLLLAAYAVPAQGLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCAL
AEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYGEQTKIERDSREHEE
PTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVIPAP
EMRQESEQGPCRRHMEASLQEFKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGIC
WCVDKYGMKLPGMEYVDGDFQCHAFDSSNVE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00219 domain.

Putative uncharacterized protein contains a PF00086 domain.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

Putative uncharacterized protein is proteolytically cut by pappalysin-1 (M43.004) cleavage..