Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1) (Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1), isoform CRA_b)

UniProt : A4D2P2, UniProt ID: A4D2P2_HUMAN,

Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1) (Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1), isoform CRA_b)

Homo sapiens

MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH
CPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKRKRKCLLL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1) (Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1), isoform CRA_b) contains a PF00071 domain.

Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1) (Ras-related C3 botulinum toxin substrate 1 (Rho family, small GTP binding protein Rac1), isoform CRA_b) is proteolytically cut by YopT peptidase (C58.001) cleavage. RKRK-CLLL.