cDNA FLJ77117, highly similar to Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA (Lysosomal-associated membrane protein 2, isoform CRA_c)

UniProt : A8K4X5, P13473, UniProt ID: A8K4X5_HUMAN, LAMP2_HUMAN,

cDNA FLJ77117, highly similar to Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA (Lysosomal-associated membrane protein 2, isoform CRA_c)

Homo sapiens

MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKT
YKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNT
GDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNG
TVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQ
LNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN
ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQG
KYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77117, highly similar to Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA (Lysosomal-associated membrane protein 2, isoform CRA_c) contains a PF01299 domain.

cDNA FLJ77117, highly similar to Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA (Lysosomal-associated membrane protein 2, isoform CRA_c) is proteolytically cut by cathepsin A (S10.002) cleavage. DDNF-LVPI.

cDNA FLJ77117, highly similar to Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA (Lysosomal-associated membrane protein 2, isoform CRA_c) is proteolytically cut by cathepsin A (S10.002) cleavage. DDNF-LVPI.

cDNA FLJ77117, highly similar to Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA (Lysosomal-associated membrane protein 2, isoform CRA_c) is proteolytically cut by serine carboxypeptidase A (S10.002) cleavage. DDNF-LVPI.