Putative uncharacterized protein ACTR3 (ARP3 actin-related protein 3 homolog (Yeast), isoform CRA_a) (cDNA, FLJ93049, Homo sapiens ARP3 actin-related protein 3 homolog (yeast) (ACTR3), mRNA)

UniProt : P61158, Q53QM2, UniProt ID: ARP3_HUMAN, Q53QM2_HUMAN,

Putative uncharacterized protein ACTR3 (ARP3 actin-related protein 3 homolog (Yeast), isoform CRA_a) (cDNA, FLJ93049, Homo sapiens ARP3 actin-related protein 3 homolog (yeast) (ACTR3), mRNA)

Homo sapiens

MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein ACTR3 (ARP3 actin-related protein 3 homolog (Yeast), isoform CRA_a) (cDNA, FLJ93049, Homo sapiens ARP3 actin-related protein 3 homolog (yeast) (ACTR3), mRNA) contains a PF00022 domain.

Putative uncharacterized protein ACTR3 (ARP3 actin-related protein 3 homolog (Yeast), isoform CRA_a) (cDNA, FLJ93049, Homo sapiens ARP3 actin-related protein 3 homolog (yeast) (ACTR3), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage..