Unique cartilage matrix-associated protein

UniProt : Q8WVF2, UniProt ID: UCMA_HUMAN,

Unique cartilage matrix-associated protein

Homo sapiens

MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKR
RGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWR
QWHYDGLHPSYLYNRHHT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Unique cartilage matrix-associated protein is proteolytically cut by furin (S08.071) cleavage. RGKR-SPKS.