Insulin-like growth factor-binding protein 6

UniProt : P47880, UniProt ID: IBP6_MOUSE,

Insulin-like growth factor-binding protein 6

Mus musculus

MTWDGLPTQPLLMLLMLLFAAGSGSALAGCPGCGPGMQTGCRGGCVEEEDAGSPADGCTE
AGGCLRREGQPCGVYSPKCAPGLQCQPRENEETPLRALLIGQGRCQRARGPSEETTKESK
PQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGA
RGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-like growth factor-binding protein 6 contains a PF00086 domain.

Insulin-like growth factor-binding protein 6 contains a PF00219 domain.

Insulin-like growth factor-binding protein 6 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. CLRR-EGQP.