CtBP-interacting BTB zinc finger protein

UniProt : Q3LR78, UniProt ID: Q3LR78_MOUSE,

CtBP-interacting BTB zinc finger protein

Mus musculus

MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKN
IFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLE
DLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFSIIETENSNNMF
SPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHSYAVSSITEAYRSQPPREQ
DSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMPLSLVTCPEVNQERSPQPAP
DLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVYNCSCCSKSFDSSTLLSAHMQ
LHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPIPGGNPPFLENYPTIGQDGTSF
RSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLYSCIVCKRSYVTLSSLRRHANVH
SWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAID
HRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPYKSYRNSSYVSAQGSSQRGESAPDT
FIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPSRQGAPTSARVKNAEGIKWRKQAVKT
NLVDNFDSTEVSVSSTGNTVSATLQTEPACVSSVGKGSEHSASVISYSGSVPSVIVHSSQ
FSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIKDSKPETDKASKPASRPKSIKEKKKTAP
SNRGEITEEAKYIADHGGSSGKTTNAEETSKIETYIAKPALPGTSTNSNVAPLCQITVKI
GNEAIVKRHILGSKLFYKRGRKPKYQMQEETLPRENDPETPGDSPLGLCQAECVEMSEAF
DEVSDQDSTDKPWRPYYNYKPKKKSKQLRKMRKVKWRKERRSRSPVGRCRYPAELDRAEV
KLPPDKAFEEEEEEEENKEMPKLQCELCDGCPDGAAGAGAEGKPHQHLTSKPYICELCAK
QFQSSSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGVKEFICQYCNKAFTL
NETLKIHERIHTGEKRYHCQFCFQGFLYLSTKRNHERRHIREHDGKGFACFQCPKICKTA
AALRMHQKKHLYKTLPKQEETGDTCHENADLLESQLCTDSEDSEQKDDIKAFAENVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00096 domain.

CtBP-interacting BTB zinc finger protein contains a PF00651 domain.

CtBP-interacting BTB zinc finger protein is proteolytically cut by caspase-3 (C14.003) cleavage. DFQD-GRNT.

CtBP-interacting BTB zinc finger protein is proteolytically cut by caspase-3 (C14.003) cleavage. DSTD-KPWR.