Collagen-alpha-3 type IX

UniProt : Q90800, UniProt ID: Q90800_CHICK,

Collagen-alpha-3 type IX

Gallus gallus

MTVFPTLGLLFLCQLLATTSAQRVGPQGPPGPRGPPGPSGKDGIDGEPGPSGLPGPPGPK
GAPGKPGAAGEAGLPGLPGVDGLTGTDGPPGPNGPPGDRGALGPAGPPGPAGKGLPGPPG
PPGPSGLPGGNGFRGPPGPSGLPGFPGPPGPPGPPGLAGIIPEGGGDLQCPALCPPGPPG
PPGMPGFKGHTGHKGEPGEIGKEGEKGSPGPPGPPGIPGSVGLQGPRGLRGLPGPMGPAG
DRGDIGFRGPPGIPGPPGRAGDQGNKGPQGFRGPKGDTGRPGPKGNPGARGLIGEPGIPG
KDGRDGAPGLDGEKGDAARMGVPGEKGPNGLPGLPGRAGIKGSKGEPGSPGEMGEAGPSG
EPGIPGDVGIPGDRGLPGPRGATGPVGLPGPIGAPGVRGFQGPKGASGEPGLPGPTGIRG
ESGDRGPAGVIGAKGSQGIAGADGLPGDKGELGPFGPPGQKGEPGKRGELGPKGAQGPNG
TAGAPGIPGHPGPMGHQGEQGVPGITGKPGPPGKEASEQHIRELCGEMINDQIAQLAANL
RKPLSPGMTGRPGPAGPPGPPGATGSVGHPGARGPPGYRGPTGELGDPGPRGDTGEKGDK
GPAGQGIDGPDGDQGPQGLPGVPGISKNGRDGAQGEPGLPGDPGTPGAVGAQGTPGICDT
SACMGAVGASTSKKS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX contains a PF01391 domain.

Collagen-alpha-3 type IX is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..