Homo sapiens

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by neprilysin (M13.001) cleavage. VNQH-LCGS.

is proteolytically cut by neprilysin (M13.001) cleavage. CGSH-LVEA.

is proteolytically cut by neprilysin (M13.001) cleavage. GSHL-VEAL.

is proteolytically cut by neprilysin (M13.001) cleavage. LVEA-LYLV.

is proteolytically cut by neprilysin (M13.001) cleavage. VEAL-YLVC.

is proteolytically cut by neprilysin (M13.001) cleavage. EALY-LVCG.

is proteolytically cut by neprilysin (M13.001) cleavage. ALYL-VCGE.

is proteolytically cut by neprilysin (M13.001) cleavage. GERG-FFYT.

is proteolytically cut by neprilysin (M13.001) cleavage. ERGF-FYTP.

is proteolytically cut by neprilysin (M13.001) cleavage. RGFF-YTPK.