RNA terminal phosphate cyclase domain 1 (RNA terminal phosphate cyclase domain 1, isoform CRA_b)

UniProt : O00442, Q5VVL6, UniProt ID: Q5VVL6_HUMAN, RTC1_HUMAN,

RNA terminal phosphate cyclase domain 1 (RNA terminal phosphate cyclase domain 1, isoform CRA_b)

Homo sapiens

MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIR
DLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELH
LKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNP
INLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAF
GNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLI
VFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIG
MTNPNL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RNA terminal phosphate cyclase domain 1 (RNA terminal phosphate cyclase domain 1, isoform CRA_b) contains a PF01137 domain.

RNA terminal phosphate cyclase domain 1 (RNA terminal phosphate cyclase domain 1, isoform CRA_b) contains a PF05189 domain.

RNA terminal phosphate cyclase domain 1 (RNA terminal phosphate cyclase domain 1, isoform CRA_b) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VEVD-GSIM.