KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a)

UniProt : P52294, Q6IBQ9, UniProt ID: IMA1_HUMAN, Q6IBQ9_HUMAN,

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a)

Homo sapiens

MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF00514 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) contains a PF01749 domain.

KPNA1 protein (Karyopherin alpha 1 (Importin alpha 5), isoform CRA_a) is proteolytically cut by caspase () cleavage. VMSD-GGFH.