Homo sapiens

MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGHVYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF
APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGPTRYSLTFEEAQQACPGTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES
HNATATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQTG
LPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTAV
PSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAETEESTEGPSATEVP
SASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEEP
YTPSPPEPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLDS
SGLTSTVGSGLTVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSGE
VLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLE
TTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETAA
PGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGV
EDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDI
SGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGL
PSGEVLETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSG
EVLETTAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEV
VETSASGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGVPSGGEGL
ETSASEVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLG
SGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTA
SELEGRGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGV
SGQPSGFPDTSGETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGITDLSGETSGVPDL
SGQPSGLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVEL
SGLPSGEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGS
SLPSGAYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMS
GEHSGFLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVT
LITSEFVEGVTEPTISQELGQRPPVTHTPQLFESSGKVSTAGDVSGATPVLPGSGVEVSS
VPESSSETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSSGLGVSGSTLT
FQEGEASAAPEVSGESTTTSDVGTEAPGLASATPTASGDRTEISGDLSGHTSQLGVVIST
SIPESEWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESEST
AAAPARSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHF
PDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHP
MQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEH
ARTFGQKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPRITCTDPTTYKRRLQK
RSSRHPRRSRPSTAH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS8 peptidase (M12.226) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS9 peptidase (M12.021) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS15 peptidase (M12.025) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS8 peptidase (M12.226) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS9 peptidase (M12.021) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS15 peptidase (M12.025) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS1 peptidase (M12.222) cleavage. IPEN-FFGV.

is proteolytically cut by ADAMTS1 peptidase (M12.222) cleavage. KEEE-GLGS.

is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. ITVQ-TVTW.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TSED-LVVQ.

is proteolytically cut by plasmin (S01.233) cleavage. GEAR-GSVI.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. TSED-LVVQ.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. ITVQ-TVTW.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. ARGS-VILT.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. TEGE-ARGS.

is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. TSED-LVVQ.

is proteolytically cut by cathepsin B (C01.060) cleavage. NFFG-VGGE.

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. TEGE-ARGS.

is proteolytically cut by atrolysin C (M12.144) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-19 (M10.021) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. TSED-LVVQ.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TVKP-IFEV.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. TSED-LVVQ.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. TSED-LVVQ.

is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IPEN-FFGV.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. IPEN-FFGV.

is proteolytically cut by plasmin (S01.233) cleavage. EARG-SVIL.

is proteolytically cut by plasminogen activator (S01.239) cleavage. RGSV-ILTV.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. RGSV-ILTV.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. IPEN-FFGV.