cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b)
UniProt : B2R4L8, P10145, UniProt ID: B2R4L8_HUMAN, IL8_HUMAN, cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) Homo sapiens MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) contains a PF00048 domain.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. RSAK-ELRC.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. QCIK-TYSK.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. TYSK-PFHP.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. KELR-CQCI.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. RSAK-ELRC.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. QCIK-TYSK.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. TYSK-PFHP.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. KELR-CQCI.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. NWVQ-RVVE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. RSAK-ELRC.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. QCIK-TYSK.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. TYSK-PFHP.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. KELR-CQCI.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. NWVQ-RVVE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by cathepsin L (C01.032) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. RSAK-ELRC.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. QCIK-TYSK.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain K (C25.002) cleavage. TYSK-PFHP.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by gingipain R (C25.001) cleavage. KELR-CQCI.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. NWVQ-RVVE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by cathepsin L (C01.032) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. VLPR-SAKE.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LPRS-AKEL.
cDNA, FLJ92140, Homo sapiens interleukin 8 (IL8), mRNA (Interleukin 8, isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VLPR-SAKE.