RNA polymerase II-associated protein 3

UniProt : Q9H6T3, UniProt ID: RPAP3_HUMAN,

RNA polymerase II-associated protein 3

Homo sapiens

MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGN
FRKKKKGKAKESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESE
SEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRL
KKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNE
LRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYER
AIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTAR
TFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI
DNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNS
SQDDLFPTSDTPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEKMPIEIEQKPAQFATT
VLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHD
FYIEKEKPLLIFEILQRLSELKRFDMAVMFMSETEKKIARALFNHIDKSGLKDSSVEELK
KRYGG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RNA polymerase II-associated protein 3 contains a PF00515 domain.

RNA polymerase II-associated protein 3 contains a PF00515 domain.

RNA polymerase II-associated protein 3 contains a PF00515 domain.

RNA polymerase II-associated protein 3 contains a PF00515 domain.

RNA polymerase II-associated protein 3 contains a PF00515 domain.

RNA polymerase II-associated protein 3 contains a PF00515 domain.

RNA polymerase II-associated protein 3 is proteolytically cut by caspase () cleavage. SEED-GIHV.

RNA polymerase II-associated protein 3 is proteolytically cut by caspase () cleavage. DVPD-STTA.