PC4 and SFRS1-interacting protein

UniProt : O75475, UniProt ID: PSIP1_HUMAN,

PC4 and SFRS1-interacting protein

Homo sapiens

MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

PC4 and SFRS1-interacting protein contains a PF00855 domain.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. EVPD-GAVKL.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. DAQD-GNQP.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. WEID-NNPK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. EVPD- GAVKL.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. DAQD-GNQP.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. WEID-NNPK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. EVPD-GAVKL.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. DAQD-GNQP.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. WEID-NNPK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. EVPD- GAVKL.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. DAQD-GNQP.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. WEID-NNPK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. DAQD-GNQP.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. WEID-NNPK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-7 (C14.004) cleavage. EVPD-GAVK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. DAQD-GNQP.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. WEID-NNPK.

PC4 and SFRS1-interacting protein is proteolytically cut by caspase-3 (C14.003) cleavage. EVPD-GAVK.