cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA

UniProt : B2R5J9, P01034, UniProt ID: B2R5J9_HUMAN, CYTC_HUMAN,

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA

Homo sapiens

MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA contains a PF00031 domain.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPPR-LVGG.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by gingipain R (C25.001) cleavage. KPPR-LVGG.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by gingipain K (C25.002) cleavage. SPGK-PPRL.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by () cleavage. PGKP-PRLV.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPPR-LVGG.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by gingipain R (C25.001) cleavage. KPPR-LVGG.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by gingipain K (C25.002) cleavage. SPGK-PPRL.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by () cleavage. PGKP-PRLV.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by cathepsin D (A01.009) cleavage. FQIY-AVPW.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by cathepsin D (A01.009) cleavage. TMTL-SKST.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by cathepsin D (A01.009) cleavage. ALDF-AVGE.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by cathepsin D (A01.009) cleavage. NYFL-DVEL.

cDNA, FLJ92502, Homo sapiens cystatin C (amyloid angiopathy and cerebralhemorrhage) (CST3), mRNA is proteolytically cut by cathepsin L (C01.032) cleavage. RLVG-GPMD.