Putative uncharacterized protein PHKG1 (HCG18830, isoform CRA_a)

UniProt : Q16816, Q75LP5, UniProt ID: PHKG1_HUMAN, Q75LP5_HUMAN,

Putative uncharacterized protein PHKG1 (HCG18830, isoform CRA_a)

Homo sapiens

MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein PHKG1 (HCG18830, isoform CRA_a) contains a PF00069 domain.

Putative uncharacterized protein PHKG1 (HCG18830, isoform CRA_a) is proteolytically cut by chymotrypsin C (S01.157) cleavage. EEVR-HFSP.

Putative uncharacterized protein PHKG1 (HCG18830, isoform CRA_a) is proteolytically cut by chymotrypsin C (S01.157) cleavage. VRHF-SPRG.

Putative uncharacterized protein PHKG1 (HCG18830, isoform CRA_a) is proteolytically cut by chymotrypsin C (S01.157) cleavage. FQQY-LVEE.