Agt protein

UniProt : Q8VCN0, UniProt ID: Q8VCN0_MOUSE,

Agt protein

Mus musculus

MTPTGAGLKATIFCILTWVSLTAGDRVYIHPFHLLYHNKSTCAQLENPSVETLPESTFEP
VPIQAKTSPVNEKTLHDQLVLAAEKLEDEDRKRAAQVAMITNFVGFRMYKMLNEAGSGAS
GAILSPPALFGTLVSFYLGSLDPTASQLQTLLDVPVKEGDCTSRLDGHKVLAALRAVQGL
LVTQGGSSSQTPLLQSIVVGLFTAPGFRLKHSFVQSLALFTPALFPRSLDLSTDPVLATE
KINRFIKAVTGWKMNLPLEGVSTDSTLLFNTYVHFQGTMRGFSQLPGVHEFWVDNSISVS
VPMISGTGNFQHWSDAQNNFSVTCVPLGERATLLLIQPHCISDLDRVEALVFQNDLLTWI
ENPPPRAIRLTLPQLEIRGSYNLQDLLAEDKLPTLLGAEANLNNIGDTNPRVGEVLNSIL
LELKAGEEEQPTTSVQQPGSPEALDVTLSSPFLFAIYEQDSGTLHFLGRVNNPQSVV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Agt protein contains a PF00079 domain.

Agt protein is proteolytically cut by renin-2 (A01.008) cleavage. PFHL-LYHN.