Sex-determining protein fem-1

UniProt : P17221, UniProt ID: FEM1_CAEEL,

Sex-determining protein fem-1

Caenorhabditis elegans

MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWIIDCFNSDQDGRYPLVIAARNGH
ANVVEYLLEIGADPSVRGVVEFDNENIQGTPPLWAASAAGHIEIVKLLIEKANADVNQAT
NTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIASYRNKVGIVEELLKTGI
DVNKKTERGNTALHDAAESGNVEVVKILLKHGSVLMKDIQGVDPLMGAALSGFLDVLNVL
ADQMPSGIHKRDALKLLGSTLLDKKMDAMSAMNCWKQSMEVPLHADDLRLVREMETFFEP
QEVYEYQREAQNIAQVELLDGNIEAQRMQALVIRERILGGAHTDVHYYLRFRGAVYCDMG
QMNRCYDLWKHALELQQKHFAPLYYGTITTLQSFHETFSMSLNDFVNNHHANRNLRVRSS
WVKYVFNGVCLELERAAAWTGAPLLEDTECCGKERCQHATEESEYKKLVYVAVHLVNVLE
RLSLPSAHIDDSDEEKEPKADVRRLMIVCHELHIPLLHHTLEERIPDSNSAELGLPKAAV
LEQLLELDLDVNATDKNNDTPMHILLRAREFRKSLVRALLVRGTWLFARNRHGDVVLNVM
KRMKALNHANFDDLPLGRHITLAGLVANAMRVKYPKKFVGVEEQMPLELRRFYLAH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 contains a PF00023 domain.

Sex-determining protein fem-1 is proteolytically cut by CED-3 peptidase (C14.002) cleavage. ELLD-GNIE.