Mucin 1, cell surface associated (HCG1996357, isoform CRA_i)

UniProt : B1AVR0, UniProt ID: B1AVR0_HUMAN,

Mucin 1, cell surface associated (HCG1996357, isoform CRA_i)

Homo sapiens

MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSF
FFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQ
LTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIA
LLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPS
STDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mucin 1, cell surface associated (HCG1996357, isoform CRA_i) contains a PF01390 domain.

Mucin 1, cell surface associated (HCG1996357, isoform CRA_i) is proteolytically cut by () cleavage. VVTG-SGHA.

Mucin 1, cell surface associated (HCG1996357, isoform CRA_i) is proteolytically cut by () cleavage. SGHA-SSTP.

Mucin 1, cell surface associated (HCG1996357, isoform CRA_i) is proteolytically cut by mucin 1 () cleavage. FRPG-SVVV.

Mucin 1, cell surface associated (HCG1996357, isoform CRA_i) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..