Mucin-1

UniProt : Q8WML4, UniProt ID: MUC1_BOVIN,

Mucin-1

Bos taurus

MTPDIQAPFLSLLLLFPVLTVANVPTLTTSDSINPRRTTPVSTTQSSPTSSPTKETSWST
TTTLLTASSPAPSPAASPGHDGASTPTSSPAPSPAASPGHDGASTPTSSPAPSPAASPGH
DGASTPTSSPAPSPAASPGHDGASTPTSSPAPSPAASPGHNGTSSPTGSPAPSPAASPGH
DGASTPTSSPAPSPAASPGHNGTSSPTGSPAPSPAASPGHDGASTPTSSPAPSPAASPGH
NGTSSPTGSPAPSPTASPGHDSAPSLTSSPAPSPTASPGQHGASSPTSSDTSSMTTRSMS
SSMVTSAHKGTSSRATMTPVSKGTPSSVPSSETAPTAASHITRTAASSPSIALSTSSNPK
TSQQLSVRVSLYFLSFRITNLQFNSSLENPQTSYYQELQRSIWGLILQIYKQRDFLGLSE
IKFRPGSVVVELTLAFREGTTAEWVKAQFSQLEAHAASYNLTISGVSVYSAPFPSSAQAG
SGVPGWGIALLVLVCVLVALAIIYLIALVVCQCGRKKCEQLDVFPTLDAYHPMSEYSTYH
THGRYVPPGSTKRSPYEEVSAGNGGSNLSYTNLAATSANL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mucin-1 contains a PF01390 domain.

Mucin-1 is proteolytically cut by Tsh peptidase (S06.003) cleavage..

Mucin-1 is proteolytically cut by Pic peptidase (S06.005) cleavage..