NADH-ubiquinone oxidoreductase chain 6

UniProt : Q8HIC5, UniProt ID: Q8HIC5_RAT,

NADH-ubiquinone oxidoreductase chain 6

Rattus norvegicus

MTNYMFILSLLFLTGCLGLALKPSPIYGGLGLIVSGCIGCLMVLGFGGSFLGLMVFLIYL
GGMLVVFGYTTAMATEEYPETWGSNWFIFSFFVLGLFMELVVFYLFSLNNKVELVDFDSL
GDWLMYEIDDVGVMLEGGIGVAAIYSCATWMMVVAGWSLFAGIFIIIEITRD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

NADH-ubiquinone oxidoreductase chain 6 contains a PF00499 domain.

NADH-ubiquinone oxidoreductase chain 6 is proteolytically cut by calpain-10 (C02.018) cleavage..