Bacteriocin mesentericin Y105

UniProt : P38577, UniProt ID: MTCY_LEUME,

Bacteriocin mesentericin Y105

Leuconostoc mesenteroides

MTNMKSVEAYQQLDNQNLKKVVGGKYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGF
W

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bacteriocin mesentericin Y105 contains a PF01721 domain.

Bacteriocin mesentericin Y105 is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. VVGG-KYYG.