Bacteriocin mesentericin Y105
UniProt : P38577, UniProt ID: MTCY_LEUME, Bacteriocin mesentericin Y105 Leuconostoc mesenteroides MTNMKSVEAYQQLDNQNLKKVVGGKYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGF W The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Bacteriocin mesentericin Y105 contains a PF01721 domain.
Bacteriocin mesentericin Y105 is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. VVGG-KYYG.