Structural polyprotein

UniProt : P27276, UniProt ID: POLS_IBDVO,

Structural polyprotein

Avian infectious bursal disease virus (strain OH)

MTNLMDHTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFF
PGFPGSVVGAHYTLQSSGSYQFDQMLLTAQNLPVSYNYCRLVSRSLTVRSSTLPGGVYAL
NGTINAVTFQGSLSELTDYSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLSYVRL
GDPIPAAGLDPKLMATCDSSDRPRVYTVTAADEYQFSSQLIPSGVKTTLFTANIDALTSL
SVGGELIFSQVTIHSIEVDVTIYFIGFDGTEVTVKAVATDFGLTTGTNNLVPFNLGGPTS
EITQPITSMKLEVVTYKRGGTAGDPISWTVSGTLAVTVHGGNYPGALRPVTLVAYERVAA
GSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREY
TDFREYFMEVADLNSPLKIAGAFGFKDIIRAIRKIAVPVVSTLFPPAAPLAHANREGVDY
LLGDEAQAASGTARGASGKARAASGRIRQLTLAADKGYEVVANMFQVPQNPIVDGILASP
GILRGAHNLDCVSKEGATLFPVVITTLEDELTPKALNSKMFAVIEGAREDLQPPSQRGSF
IRTLSGHRVYGYAPDGVLPLETGRDYTVVPIDDVWDDSIMLSQDPIPPIVGNSGNLAIAY
MDVFRPKVPIHVAMTGALNASEIESVSFRSTKLATAHRLGMKLAGPGDYDINTGPNWATF
IKRFPHNPRGWDRLPYLNLPYLPPTAGRQFHLALAASEFKETPELEDAVRAMDAAANADP
LFRSALQVFMWLEENGIVTDMANFALSDPNAHRMKNFLANAPQAGSKSQRAKYGTAGYGV
EARGPTPEEAQRAKDARISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPEP
NEDYPDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVARVYETNHGRVPNQE
QMKDLLLTAMEMKHRNPRRAPPKPKPKPNAPSQRPPGRLGRWIRTVSDEDLE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Structural polyprotein contains a PF01766 domain.

Structural polyprotein contains a PF01768 domain.

Structural polyprotein contains a PF01767 domain.

Structural polyprotein is proteolytically cut by infectious pancreatic necrosis birnavirus Vp4 peptidase (S50.001) cleavage. TFIK-RFPH.

Structural polyprotein is proteolytically cut by infectious pancreatic necrosis birnavirus Vp4 peptidase (S50.001) cleavage. RAIR-KIAV.