Interferon, beta 1, fibroblast (Interferon beta)
|
UniProt : P01574, Q5VWC9, UniProt ID: IFNB_HUMAN, Q5VWC9_HUMAN, Interferon, beta 1, fibroblast (Interferon beta) Homo sapiens MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LTGYLRN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Interferon, beta 1, fibroblast (Interferon beta) contains a PF00143 domain.
Interferon, beta 1, fibroblast (Interferon beta) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IVEN-LLAN.