Interferon, beta 1, fibroblast (Interferon beta)

UniProt : P01574, Q5VWC9, UniProt ID: IFNB_HUMAN, Q5VWC9_HUMAN,

Interferon, beta 1, fibroblast (Interferon beta)

Homo sapiens

MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interferon, beta 1, fibroblast (Interferon beta) contains a PF00143 domain.

Interferon, beta 1, fibroblast (Interferon beta) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IVEN-LLAN.