CAMP responsive element binding protein 1 (CAMP responsive element binding protein 1, isoform CRA_a) (cDNA, FLJ93156, Homo sapiens cAMP responsive element binding protein 1 (CREB1),transcript variant B, mRNA)

UniProt : P16220, Q5U0J5, UniProt ID: CREB1_HUMAN, Q5U0J5_HUMAN,

CAMP responsive element binding protein 1 (CAMP responsive element binding protein 1, isoform CRA_a) (cDNA, FLJ93156, Homo sapiens cAMP responsive element binding protein 1 (CREB1),transcript variant B, mRNA)

Homo sapiens

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CAMP responsive element binding protein 1 (CAMP responsive element binding protein 1, isoform CRA_a) (cDNA, FLJ93156, Homo sapiens cAMP responsive element binding protein 1 (CREB1),transcript variant B, mRNA) contains a PF00170 domain.

CAMP responsive element binding protein 1 (CAMP responsive element binding protein 1, isoform CRA_a) (cDNA, FLJ93156, Homo sapiens cAMP responsive element binding protein 1 (CREB1),transcript variant B, mRNA) contains a PF02173 domain.

CAMP responsive element binding protein 1 (CAMP responsive element binding protein 1, isoform CRA_a) (cDNA, FLJ93156, Homo sapiens cAMP responsive element binding protein 1 (CREB1),transcript variant B, mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage..

CAMP responsive element binding protein 1 (CAMP responsive element binding protein 1, isoform CRA_a) (cDNA, FLJ93156, Homo sapiens cAMP responsive element binding protein 1 (CREB1),transcript variant B, mRNA) is proteolytically cut by caspase-7 (C14.004) cleavage..