Hepatocyte odd protein shuttling protein (Chromosome 7 open reading frame 21, isoform CRA_a) (cDNA, FLJ94695)

UniProt : Q53AQ2, Q9BVT8, UniProt ID: Q53AQ2_HUMAN, TMUB1_HUMAN,

Hepatocyte odd protein shuttling protein (Chromosome 7 open reading frame 21, isoform CRA_a) (cDNA, FLJ94695)

Homo sapiens

MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATD
SMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAW
PHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNP
PCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLA
FAMYRP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hepatocyte odd protein shuttling protein (Chromosome 7 open reading frame 21, isoform CRA_a) (cDNA, FLJ94695) contains a PF00240 domain.

Hepatocyte odd protein shuttling protein (Chromosome 7 open reading frame 21, isoform CRA_a) (cDNA, FLJ94695) is proteolytically cut by caspase () cleavage. AATD-SMRG.