LexA repressor

UniProt : P31080, UniProt ID: LEXA_BACSU,

LexA repressor

Bacillus subtilis

MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP
TKPRAIEILDEEVDIPQSQVVNVPVIGKVTAGSPITAVENIEEYFPLPDRMVPPDEHVFM
LEIMGDSMIDAGILDKDYVIVKQQNTANNGEIVVAMTEDDEATVKRFYKEDTHIRLQPEN
PTMEPIILQNVSILGKVIGVFRTVH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

LexA repressor contains a PF00717 domain.

LexA repressor contains a PF01726 domain.

LexA repressor is proteolytically cut by repressor LexA (S24.001) cleavage. KVTA-GSPI.