LexA repressor
|
UniProt : P31080, UniProt ID: LEXA_BACSU, LexA repressor Bacillus subtilis MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP TKPRAIEILDEEVDIPQSQVVNVPVIGKVTAGSPITAVENIEEYFPLPDRMVPPDEHVFM LEIMGDSMIDAGILDKDYVIVKQQNTANNGEIVVAMTEDDEATVKRFYKEDTHIRLQPEN PTMEPIILQNVSILGKVIGVFRTVH The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
LexA repressor contains a PF00717 domain.
LexA repressor contains a PF01726 domain.
LexA repressor is proteolytically cut by repressor LexA (S24.001) cleavage. KVTA-GSPI.