IgA protease

UniProt : Q9AES2, UniProt ID: Q9AES2_9FIRM,

IgA protease

Clostridium ramosum

MTKKLMTKKITAIFLALYMAISVLPMTIQAASKPDIKVGDYVKMGVYNNASILWRCVSID
NNGPLMLADKIVDTLAYDAKTNDNSNSKSHSRSYKRDDYGSNYWKDSNMRSWLNSTAAEG
KVDWLCGNPPKDGYVSGVGAYNEKAGFLNAFSKSEIAAMKTVTQRSLVSHPEYNKGIVDG
DANSDLLYYTDISEAVANYDSSYFETTTEKVFLLDVKQANAVWKNLKGYYVAYNNDGMAW
PYWLRTPVTDCNHDMRYISSSGQVGRYAPWYSDLGVRPAFYLDSEYFVTTSGSGSQSSPY
IGSAPNKQEDDYTISEPAEDANPDWNVSTEQSIQLTLGPWYSNDGKYSNPTIPVYTIQKT
RSDTENMVVVVCGEGYTKSQQGKFINDVKRLWQDAMKYEPYRSYADRFNVYALCTASEST
FDNGGSTFFDVIVDKYNSPVISNNLHGSQWKNHIFERCIGPEFIEKIHDAHIKKKCDPNT
IPSGSEYEPYYYVHDYIAQFAMVVNTKSDFGGAYNNREYGFHYFISPSDSYRASKTFAHE
FGHGLLGLGDEYSNGYLLDDKELKSLNLSSVEDPEKIKWRQLLGFRNTYTCRNAYGSKML
VSSYECIMRDTNYQFCEVCRLQGFKRMSQLVKDVDLYVATPEVKEYTGAYSKPSDFTDLE
TSSYYNYTYNRNDRLLSGNSKSRFNTNMNGKKIELRTVIQNISDKNARQLKFKMWIKHSD
GSVATDSSGNPLQTVQTFDIPVWNDKANFWPLGALDHIKSDFNSGLKSCSLIYQIPSDAQ
LKSGDTVAFQVLDENGNVLADDNTETQRYTTVSIQYKFEDGSEIPNTAGGTFTVPYGTKL
DLTPAKTLYDYEFIKVDGLNKPIVSDGTVVTYYYKNKNEEHTHNLTLVAAKAATCTTAGN
SAYYTCDGCDKWFADATGSVEITDKTSVKIPAPGHTAGTEWKSDDTNHWHECTVAGCGVI
IESTKSAHTAGEWIVDTPATATTAGTKHKECTVCHRVLETQPIPSTGTELKIIAGDNQIY
NKASGSDVTITCNGDFAKFTGIKVDGSVVDSSNYTAVSGSTVLTLKASYLGTLTDGSHTI
TFVYTDGEANANLTVRTAGSGHIHDYGTEWKSNADNHWHECNCGDKKDEAAHSFKWVVDK
EATATKKGSKHEECKICGYKRSAVEIPATGTSTAPTDTTKPNDTTKPGNTNGSEKSPQTG
DNSNIFLWFALLFVSAAGVTGITAYNKKKKEHAE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

IgA protease contains a PF03442 domain.

IgA protease is proteolytically cut by signal peptidase I (S26.001) cleavage. TIQA-ASKP.

IgA protease is proteolytically cut by sortase A (C60.001) cleavage. SPQT-GDNS.