Brain-derived neurotrophic factor
|
Brain-derived neurotrophic factor Rattus norvegicus MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTS LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV CTLTIKRGR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Brain-derived neurotrophic factor contains a PF00243 domain.
Brain-derived neurotrophic factor is proteolytically cut by plasmin (S01.233) cleavage..
Brain-derived neurotrophic factor is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..