Brain-derived neurotrophic factor BDNF2B

UniProt : P23560, Q598Q1, UniProt ID: BDNF_HUMAN, Q598Q1_HUMAN,

Brain-derived neurotrophic factor BDNF2B

Homo sapiens

MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Brain-derived neurotrophic factor BDNF2B contains a PF00243 domain.

Brain-derived neurotrophic factor BDNF2B is proteolytically cut by plasmin (S01.233) cleavage. MSMR-VRRH.

Brain-derived neurotrophic factor BDNF2B is proteolytically cut by plasmin (S01.233) cleavage. MSMR-VRRH.

Brain-derived neurotrophic factor BDNF2B is proteolytically cut by site-1 peptidase (S08.063) cleavage. RGLT-SLAD.