Brain-derived neurotrophic factor BDNF2B
|
UniProt : P23560, Q598Q1, UniProt ID: BDNF_HUMAN, Q598Q1_HUMAN, Brain-derived neurotrophic factor BDNF2B Homo sapiens MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT LTIKRGR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Brain-derived neurotrophic factor BDNF2B contains a PF00243 domain.
Brain-derived neurotrophic factor BDNF2B is proteolytically cut by plasmin (S01.233) cleavage. MSMR-VRRH.
Brain-derived neurotrophic factor BDNF2B is proteolytically cut by plasmin (S01.233) cleavage. MSMR-VRRH.
Brain-derived neurotrophic factor BDNF2B is proteolytically cut by site-1 peptidase (S08.063) cleavage. RGLT-SLAD.