Elastin

UniProt : P15502, UniProt ID: ELN_HUMAN,

Elastin

Homo sapiens

MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGG
KPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGG
LGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAP
GVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAG
KAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGT
PAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIP
GAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGV
PSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGPQAAVPGVPGTGGV
PGVGTPAAAAAKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAP
GVGVAPGIGPGGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGL
GVGAGVPGFGAGADEGVRRSLSPELREGDPSSSQHLPSTPSSPRVPGALAAAKAAKYGAA
VPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVP
GVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKA
CGRKRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. VPGG-VFYP.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. VPGG-LAGA.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. PGVP-LGYP.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GIGG-IAGV.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. AKAQ-LRAA.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. AAAG-LGAG.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. KAAK-YGAA.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GLGA-LGGV.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. IPGG-VVGA.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. KAAQ-FGLV.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GVGG-LGGI.

Elastin is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GAAG-LGGV.