T-cell acute lymphocytic leukemia protein 1

UniProt : P17542, UniProt ID: TAL1_HUMAN,

T-cell acute lymphocytic leukemia protein 1

Homo sapiens

MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
PDSYTEEPAPKHTARSLHPAMLPAADGAGPR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

T-cell acute lymphocytic leukemia protein 1 contains a PF00010 domain.

T-cell acute lymphocytic leukemia protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. EITD-GPHT.

T-cell acute lymphocytic leukemia protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. SSLD-GAAS.

T-cell acute lymphocytic leukemia protein 1 is proteolytically cut by caspase-7 (C14.004) cleavage. EITD-GPHT.

T-cell acute lymphocytic leukemia protein 1 is proteolytically cut by caspase-7 (C14.004) cleavage. SSLD-GAAS.

T-cell acute lymphocytic leukemia protein 1 is proteolytically cut by caspase-8 (C14.009) cleavage. EITD-GPHT.

T-cell acute lymphocytic leukemia protein 1 is proteolytically cut by caspase-8 (C14.009) cleavage. SSLD-GAAS.