Leukocyte cell derived chemotaxin 1 (LECT1 protein)

UniProt : O75829, Q5TAM4, UniProt ID: LECT1_HUMAN, Q5TAM4_HUMAN,

Leukocyte cell derived chemotaxin 1 (LECT1 protein)

Homo sapiens

MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIG
AFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGI
TGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVK
DNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGR
LNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPL
GGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Leukocyte cell derived chemotaxin 1 (LECT1 protein) contains a PF04089 domain.

Leukocyte cell derived chemotaxin 1 (LECT1 protein) is proteolytically cut by furin (S08.071) cleavage. RERR-EVVR.