cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b)

UniProt : B2R6D3, P49768, UniProt ID: B2R6D3_HUMAN, PSN1_HUMAN,

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b)

Homo sapiens

MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) contains a PF01080 domain.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by caspase () cleavage. ENDD-GGFS.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by caspase-8 (C14.009) cleavage. ENDD-GGFS.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by caspase-7 (C14.004) cleavage. AQRD-SHLG.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by caspase-6 (C14.005) cleavage. ENDD-GGFS.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. AQRD-SHLG.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by caspase-1 (C14.001) cleavage. AQRD-SHLG.

cDNA, FLJ92900, Homo sapiens presenilin 1 (Alzheimer disease 3) (PSEN1), transcriptvariant I-467, mRNA (Presenilin 1 (Alzheimer disease 3), isoform CRA_b) is proteolytically cut by memapsin-2 (A01.004) cleavage. LVNM-AEGD.