Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a)

UniProt : B5BU79, P52566, UniProt ID: B5BU79_HUMAN, GDIR2_HUMAN,

Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a)

Homo sapiens

MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIV
SGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTD
DDKQDHLSWEWNLSIKKEWTE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a) contains a PF02115 domain.

Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a) is proteolytically cut by caspase () cleavage. DELD-SKLN.

Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a) is proteolytically cut by caspase () cleavage. DELD-SKLN.

Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DELD-SKLN.

Rho GDP-dissociation inhibitor 2 (Rho GDP dissociation inhibitor (GDI) beta, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DELD-SKLN.