Rabphilin-3A

UniProt : P47709, UniProt ID: RP3A_RAT,

Rabphilin-3A

Rattus norvegicus

MTDTVVNRWMYPGDGPLQSNDKEQLQAGWSVHPGAQTDRQRKQEELTDEEKEIINRVIAR
AEKMETMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCT
KCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPAGE
PATQEQPTPESRHPARAPARGDMEDRRAPGQKPGPDLTSAPGRGSHGPPTRRASEARMST
TTRDSEGWDHGHGGGAGDTSRSPGGEQGLRRANSVQASRPAPASMPSPAPPQPVQPGPPG
GSRAAPGPGRFPEQSTEAPPSDPGYPGAVAPAREERTGPTGGFQAAPHTAGPYSQAAPAR
QPPPAEEEEEEANSYDSDQATTLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADP
YVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGH
NEFIGETRFSLKKLKANQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEE
RGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKK
KTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYE
CLKNKDKKIERWHQLQNENHVSSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Rabphilin-3A contains a PF00168 domain.

Rabphilin-3A contains a PF00168 domain.

Rabphilin-3A contains a PF02318 domain.

Rabphilin-3A is proteolytically cut by calpain-2 (C02.002) cleavage..